FOXO4-DRI Peptide (10MG) For Sale
Description
FOXO4-DRI Peptide (10MG) is a premium research peptide widely studied for its potential role in cellular aging research, senescence-related studies, and advanced peptide-based scientific exploration. Known for its connection to FOXO4 protein interaction pathways, FOXO4-DRI has gained significant attention among researchers investigating cellular longevity, damaged cell signaling, and regenerative biological processes. This research-grade 10MG formulation is manufactured exclusively for laboratory and scientific research applications.
FOXO4-DRI is a specialized peptide designed to interact with pathways associated with cellular senescence and biological maintenance mechanisms. Researchers continue to explore how this peptide may influence communication between senescent cells and surrounding biological systems within controlled research models. Due to its growing relevance in longevity-focused science, FOXO4-DRI Peptide has become increasingly popular among laboratories studying cellular health, regenerative pathways, and age-related biological activity.
The FOXO4-DRI Peptide (10MG) format provides laboratories and scientific professionals with a convenient concentration suitable for precise peptide handling, accurate measurement, and structured experimental protocols. Each vial is manufactured using advanced peptide synthesis methods and rigorous quality assurance standards to support purity, consistency, and dependable laboratory performance. Strict manufacturing procedures help maintain peptide integrity and stability throughout scientific use.
Within peptide research environments, FOXO4-DRI is frequently examined for its relationship to senescent cell signaling pathways, cellular communication mechanisms, and tissue-support biological models. Ongoing scientific studies continue to investigate how this peptide may interact with pathways associated with cellular repair, biological resilience, and regenerative research processes. Its expanding role in advanced peptide science has contributed to increasing interest from longevity-focused research communities worldwide.
Researchers are particularly interested in FOXO4-DRI because of its potential relevance in studies involving age-related cellular behavior and biological maintenance systems. Scientific investigations often focus on how this peptide may influence signaling pathways connected to cellular stress responses, tissue organization, and regenerative activity within controlled laboratory environments. Because of these growing areas of scientific exploration, FOXO4-DRI remains a highly востребованный compound in modern peptide and longevity research.
The 10MG concentration offers flexibility for detailed laboratory applications requiring carefully measured peptide quantities. Researchers value FOXO4-DRI for its compatibility with advanced scientific environments and its increasing importance in innovative peptide-based investigations. Proper storage conditions and laboratory handling procedures are recommended to help preserve peptide stability and support consistent research outcomes.
Every batch of FOXO4-DRI Peptide (10MG) undergoes comprehensive quality testing designed to support laboratory-grade purity, accurate identification, and research consistency. Controlled manufacturing environments and professional peptide synthesis standards help ensure dependable scientific performance across research applications. Laboratories seeking reliable peptide compounds often prioritize products manufactured with precision and strict quality assurance procedures.
As peptide science continues to advance, FOXO4-DRI remains an important compound within cellular aging research, regenerative science investigations, and senescence-focused peptide studies. Its growing popularity in advanced laboratory research has made it a valuable addition to professional peptide inventories dedicated to scientific innovation and precision-driven peptide exploration.
FOXO4-DRI Peptide (10MG) is intended strictly for scientific and laboratory research purposes only. It is not intended for human consumption, therapeutic use, or medical application. All peptide research should be conducted by qualified professionals following proper laboratory guidelines and safety standards.
For researchers seeking a high-quality longevity research peptide, FOXO4-DRI Peptide (10MG) offers exceptional purity, trusted manufacturing standards, and strong relevance within modern peptide science and advanced laboratory-based research.
FOXO4-DRI Peptide Information
FORM |
Powder (lyophilized) |
|---|---|
CAS NUMBER |
2460055-10-9 |
SEQUENCE |
LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG |
OTHER NAMES |
FOXO4-DRI |
WEIGHT |
10mg |
Molecular Weight |
5358.05 g/mol |
Terms |
Subject to our Terms and Conditions. This material is sold for laboratory research use only. Not for human consumption, animal, or medical use. |
Why isn’t there more information on FOXO4-DRI?
Due to the legal landscape of peptides and research products, providing information that may imply anything beyond laboratory research use is a legal liability. We’re an expert biotechnology company that provides high quality peptides and products for purchase to advance scientific research in this field.
This product is in powder form and is not reconstituted.
















Reviews
There are no reviews yet.